SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9UY86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9UY86
Domain Number 1 Region: 187-282
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000497
Family Multidrug resistance efflux transporter EmrE 0.03
Further Details:      
 
Domain Number 2 Region: 45-142
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000314
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9UY86
Sequence length 299
Comment (tr|V9UY86|V9UY86_9PSED) Membrane protein {ECO:0000313|EMBL:AHC87626.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_09455 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQSHFSKGLLFALCAAALNATIGVLSKVLMNSGFSSSSIALIKTVLGCLLLSALLLFLKR
PLHTAKWFHAAVCAFLGIFVLFHFETSAYSHYAAAGVVVILMASASISSILLGRIVLKDP
ITANATVGAGLTIAGIAVIFGADLDQGFTLQGAMLAATGGCGYGAFSVAMKRMGVSGGLH
FTRQLLFFGSLYLLMPAATDGFIIGELSPGAVLALLALAALPTILGFFCTTKAIEYLKPS
QVQALELTEPLFAALLAFVVLNEVPRDTLYLGAGLILFGLCFSNELIRLGKKAPQPSKA
Download sequence
Identical sequences A0A059URZ6 A0A099MZZ9 V7DGG4 V9UY86
gi|568187099|ref|YP_008959653.1| WP_023660554.1.23948 WP_023660554.1.28354 WP_023660554.1.35335 WP_023660554.1.65739 WP_023660554.1.7288 WP_023660554.1.80759 gi|568181719|ref|YP_008954282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]