SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9UZJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9UZJ0
Domain Number 1 Region: 8-189,258-335
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.81e-64
Family Crotonase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9UZJ0
Sequence length 355
Comment (tr|V9UZJ0|V9UZJ0_9PSED) Crotonase {ECO:0000313|EMBL:AHC87832.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_10555 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSDTEVPVLAEVRNRVGHLALNRPVGLNALTLQMIRITWRQLHAWESDPEIVAVVLRANG
EKAFCAGGDIRSLYDSYQAGDDLHHVFLEEKYSLDQYIHGYPKPIVALMDGFVLGGGMGL
VQGTALRVVTERVKMGMPETSIGYFPDVGGSNFLPRLPGELGLYLGITGIQIRAADALYA
RLADWCLPSERISEFDRRLDQISWGYAPREILAGLLSSLASNRLLGAELKSLHPAIDEHF
TQPDLSAIRASLQAERRPEYQDWAEQTVELLNNRSPLAMSATLKLLRLGRTLSLANCFEL
ELHLERQWFAKGDLIEGVRALLIDKDKTPRWNPPTLEQLDTNRVNEFFDGFQPAT
Download sequence
Identical sequences V9UZJ0
gi|568181925|ref|YP_008954497.1| WP_024086921.1.23948 WP_024086921.1.28354 gi|568187305|ref|YP_008959867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]