SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V052 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V052
Domain Number 1 Region: 39-206
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.87e-37
Family Clp protease, ClpP subunit 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9V052
Sequence length 388
Comment (tr|V9V052|V9V052_9PSED) ATP-dependent Clp protease proteolytic subunit {ECO:0000256|RuleBase:RU003567} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_11930 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKPLMPFRIFNKAKALLPVEDGHWYSITAAAPEGDAGSKVIEVYVYGEIGAWGITANQFI
QELKAVDDGVSPVVVAFNTNGGDLFEGLAIHNALSRLGERCTGRVDALAASAGSVAVCGA
HRVVMASNAMLMIHNPYTWAGGDADELRRVADVLDQAFEVIIAAYKAKAPDIDEDELRRL
VNAETWLTASEALALGLADEVGDGVKVQACLGQGAAMARYRNTPQALLDQLKASKDEPTE
PVVNEPENEPAVPQPTASDSTALALMITKACTQAGISNLVEPLIASTKLADEATVQAALT
RAKAVRDLCVAARLPEMTGEYVQAGLDATAVRVRLFDKLVGNGKGFEIDNSLPPADDLPE
KVQAKAPNPSGIWAARRQATQPRPGQGA
Download sequence
Identical sequences V9V052
WP_024087072.1.23948 WP_024087072.1.28354 gi|568187535|ref|YP_008960134.1| gi|568182157|ref|YP_008954766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]