SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V146 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V146
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 2.23e-85
Family Aldo-keto reductases (NADP) 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V9V146
Sequence length 274
Comment (tr|V9V146|V9V146_9PSED) Aldo/keto reductase {ECO:0000313|EMBL:AHC88626.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_14915 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQRLTTRNGLALPAIGLGTWPMTGSECTQAVRQALELGYRHIDTATAYDNEAAVGQALRE
SDVPREQIHLTTKVWWDRLAPKAMRQSLEDSLRALGTEQVDLFHIHWPSQDWDLARSIET
LVALRDEGKARSIGVANFPLGLLRQVVENLGAPLSAIQVEYHVLLGQQPLLDYARRHDLL
LTAYTPLARGQAAAQPVIQAIARKHGVLPSQVALKWLLDQDGVAVIPKAGSRENQLANLA
ASNVQLDDEDRAAIAGLPKDQRVVSPAFAPDWNS
Download sequence
Identical sequences V9V146
WP_024087318.1.23948 WP_024087318.1.28354 gi|568188099|ref|YP_008960721.1| gi|568182721|ref|YP_008955353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]