SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V268 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V268
Domain Number 1 Region: 8-199,268-338
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.05e-72
Family Crotonase-like 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V9V268
Sequence length 356
Comment (tr|V9V268|V9V268_9PSED) Crotonase {ECO:0000313|EMBL:AHC88428.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_13895 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTAHAHTSATDHVLAEVRNQIGHLTLNRPAGLNALTLDMVRSLRQHLDQWAEDPHVHAVV
LRGEGPKGFCAGGDIRSLHDSFKAGDTLHETFFVEEYALDLAIHRYRKPVLVLMDGFTLG
GGMGLAQGCDLRVVTERSRLGMPEVAIGYFPDVGGSYFLSRIPGELGIYLGVSGSQIQAA
DALYCGLADWYLASDQLAALDQGLDQLRFGDQPLKDLQNLLAKLGTQVLDDAPLEKLRPV
IDHFFALTDVPAMVEQLRAVSIGDSHAWAVATADQLESRSPLAMAVTLEMLRRGRHLSLD
DCFAMELHLDRQWFQHGDIIEGVRALIIDKDKQPRWNPPTLAALQRQRVDQFFEGL
Download sequence
Identical sequences V9V268
gi|568182523|ref|YP_008955151.1| gi|568187901|ref|YP_008960519.1| WP_024087236.1.23948 WP_024087236.1.28354 WP_024087236.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]