SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V9V2F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V2F1
Domain Number 1 Region: 76-200
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.01e-43
Family Tetracyclin repressor-like, C-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 3-78
Classification Level Classification E-value
Superfamily Homeodomain-like 6.16e-19
Family Tetracyclin repressor-like, N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9V2F1
Sequence length 203
Comment (tr|V9V2F1|V9V2F1_9PSED) TetR family transcriptional regulator {ECO:0000313|EMBL:AHC89081.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_17380 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSTIRERNKELILRAASEEFADKGFAATKTSDIAAKAGLPKPNVYYYFKSKDNLYREVLE
SIIAPIMQASTPFNADGDPKEVLSAYIRSKIRISRDLPHASKVFASEIMHGAPHLSPNQV
AQLNEQARHNIECIQRWIDRGQIAHVDAHHLMFSIWAATQTYADFDWQISAVTGKAKLAD
SDYDAAAETIIRMVLKGCEPEVA
Download sequence
Identical sequences A0A059UVC2 A0A099N4K4 A0A0C1I3R8 A0A0Q4NDT0 A0A1L5PU22 F8FTX7 V7DB20 V9V2F1
gi|339488592|ref|YP_004703120.1| gi|568183178|ref|YP_008955838.1| WP_013973538.1.12409 WP_013973538.1.15314 WP_013973538.1.1643 WP_013973538.1.23948 WP_013973538.1.28354 WP_013973538.1.33515 WP_013973538.1.35335 WP_013973538.1.42658 WP_013973538.1.56258 WP_013973538.1.59340 WP_013973538.1.65739 WP_013973538.1.7288 WP_013973538.1.7435 WP_013973538.1.78427 WP_013973538.1.80759 gi|568188554|ref|YP_008961204.1| 2035945291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]