SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V2T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V2T3
Domain Number 1 Region: 9-257
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.82e-80
Family Crotonase-like 0.000000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9V2T3
Sequence length 257
Comment (tr|V9V2T3|V9V2T3_9PSED) 2,3-dehydroadipyl-CoA hydratase {ECO:0000313|EMBL:AHC88150.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_12415 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MPRYLDVQAPEQGVQLITLQRPEALNALCTELLAELAAALEAAGQDEQTRAVVITGSRKA
FAAGADIREMAERDLVGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELVMCADIVI
AGSDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITAPHALQAGLVSEIT
QPELTVERALHIARGIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLLAGTADRD
EGIRAFQEKRQARFQGR
Download sequence
Identical sequences A0A099MZ95 V7D504 V9V2T3
gi|568182245|ref|YP_008954861.1| gi|568187623|ref|YP_008960229.1| WP_023663238.1.23948 WP_023663238.1.28354 WP_023663238.1.65739 WP_023663238.1.7288 WP_023663238.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]