SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V455 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V455
Domain Number 1 Region: 2-246
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.12e-64
Family Crotonase-like 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9V455
Sequence length 248
Comment (tr|V9V455|V9V455_9PSED) Enoyl-CoA hydratase {ECO:0000313|EMBL:AHC88650.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_15035 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNDLITRDLDQGLLTLSFNRPDKLNAVNTAMYQQLGDLLLAAGEDPDVEAIIITGGPQCF
TAGNDLRDFLDNPPADLDSPVFRLMRVVMGLDKPLIAAVSGAAIGIGATLLLHCDQVLVS
RTTKLRIPFAPLGVCPEFGSSLLLPRLLGPARAARLLLANELLDGERMVAWGLANELHDD
GEQCLAAARRLARQLQGYPQAALRISKRLLKDGQRAELEATVAREARLFIECLRTEEARA
VLRGLIKD
Download sequence
Identical sequences A0A059V313 F8G342 V9V455
gi|568188123|ref|YP_008960745.1| gi|339488099|ref|YP_004702627.1| gi|568182745|ref|YP_008955377.1| WP_013973086.1.23948 WP_013973086.1.28354 WP_013973086.1.35335 WP_013973086.1.56258 WP_013973086.1.65739 WP_013973086.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]