SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V472 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V472
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily Homeodomain-like 6.67e-20
Family Tetracyclin repressor-like, N-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 84-201
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.37e-16
Family Tetracyclin repressor-like, C-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9V472
Sequence length 210
Comment (tr|V9V472|V9V472_9PSED) TetR family transcriptional regulator {ECO:0000313|EMBL:AHC89686.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_20635 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MVRRTKEEAQETRAQIIEAAEKAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQ
ALLDSLHETHDHLARASESEDEVDPLGCMRKLLLQVFNELVLDARTRRINEILHHKCEFT
DDMCEIRQQRQAAVLDCHKGITLALANAVRRGQLPGELDVERAAVAMFAYVDGLIGRWLL
LPDSVDLLKDVEKWVDTGLDMLRLSPALRK
Download sequence
Identical sequences A0A059V567 A0A099N569 A0A0C1KSF2 A0A136QI95 F8G4A8 L0FMK5 V7DHA7 V9V472
gi|339489153|ref|YP_004703681.1| gi|568189159|ref|YP_008961838.1| WP_013974034.1.1643 WP_013974034.1.23948 WP_013974034.1.28354 WP_013974034.1.35335 WP_013974034.1.56258 WP_013974034.1.57632 WP_013974034.1.65739 WP_013974034.1.71677 WP_013974034.1.7288 WP_013974034.1.7435 WP_013974034.1.80759 WP_013974034.1.95946 gi|431804219|ref|YP_007231122.1| gi|568183786|ref|YP_008956475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]