SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V4K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V4K1
Domain Number 1 Region: 89-200,231-290
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.85e-28
Family Biotin dependent carboxylase carboxyltransferase domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V9V4K1
Sequence length 339
Comment (tr|V9V4K1|V9V4K1_9PSED) Peptidase {ECO:0000313|EMBL:AHC88780.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_15745 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEFLAEYASFLAKTATLVIAILIVLSAIAGLRGKGRRKSGGQLQVTRLNEFYKDLRERLE
SGLLDKAQLKALRKQQAKAEKRQKKSKAEEKGRVFVLDFDGDIKASATESLRNEITALLT
LATPRDEVVLRLESGGGLVHSYGLAASQLARIRQAGIPLTVCIDKVAASGGYMMACIGEK
IVSAPFAVLGSIGVVAQLPNVNRLLKKHDIDFEVLTAGEYKRTLTVFGENTEKGREKFQE
DLDITHQLFKDFVARYRPQLHIDEVATGEVWLGVAALNRKLVDELQTSDEYLSERARNAN
LFHLHYAERKSLQERIGMAASGTVENTVVGLWSKLGRLR
Download sequence
Identical sequences A0A059V3H3 F8G519 V9V4K1
gi|568182875|ref|YP_008955516.1| gi|568188253|ref|YP_008960884.1| WP_013973207.1.1643 WP_013973207.1.23948 WP_013973207.1.28354 WP_013973207.1.35335 WP_013973207.1.56258 WP_013973207.1.65739 WP_013973207.1.7288 gi|339488230|ref|YP_004702758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]