SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V5Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V5Q0
Domain Number 1 Region: 75-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.85e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.33e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9V5Q0
Sequence length 220
Comment (tr|V9V5Q0|V9V5Q0_9PSED) Glutathione S-transferase {ECO:0000313|EMBL:AHC90844.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_26640 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MLKLHGFSVSNYYNMVKLALLEKGLPFEEITFYGGQAPQALEVSPRGKVPVLQTEHGFLS
ETSVILDYIEQTQGGKALLPADPFGQAKVRELLKEIELYIELPARTCYAESFFGMSVEPL
VKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCFSVDLAYAVGKKVLNIDFLAD
FPQAKALLQLMGENPHMARIVADKEAAMPAFMEIIRSGKR
Download sequence
Identical sequences F8FVP5 V9V5Q0
WP_013970380.1.23948 WP_013970380.1.28354 WP_013970380.1.56258 gi|568190317|ref|YP_008963018.1| gi|339485098|ref|YP_004699626.1| gi|568184947|ref|YP_008957658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]