SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V670 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V670
Domain Number 1 Region: 6-278
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.57e-96
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000031
Further Details:      
 
Domain Number 2 Region: 281-396
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 9.37e-34
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9V670
Sequence length 403
Comment (tr|V9V670|V9V670_9PSED) Cytochrome b {ECO:0000256|RuleBase:RU003385} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_21180 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSKFMDWIDARFPATKMWEDHLSKYYAPKNFNFLYFFGSLALLVLVNQIVTGVWLTMSFT
PSAEEAFASVEYIMRDVEYGWILRYLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVWL
FGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGGDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKKKDENGIPLDGIPFHPYY
TVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEQANAFKTPEHIAPVWYFTPFYAIL
RAVPDKLMGVIAMGAAIAVLFVLPWLDRSPVRSMRYKGWISKLFLLVFCVAFVILGILGV
LAPTPGRTLLSQVCTVLYFAYFLLMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A0C1IAM3 A0A0P7C511 A0A136QIJ7 A0A2A3M5N7 J8V6A9 L0FRJ9 V7D7W7 V9V670
WP_003260795.1.23948 WP_003260795.1.28354 WP_003260795.1.35335 WP_003260795.1.56258 WP_003260795.1.57632 WP_003260795.1.65739 WP_003260795.1.71677 WP_003260795.1.7288 WP_003260795.1.7435 WP_003260795.1.80759 WP_003260795.1.95946 gi|568183893|ref|YP_008956582.1| gi|431804330|ref|YP_007231233.1| gi|568189266|ref|YP_008961945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]