SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V7G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V7G9
Domain Number 1 Region: 111-232
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000621
Family Tropomyosin 0.0066
Further Details:      
 
Weak hits

Sequence:  V9V7G9
Domain Number - Region: 47-120
Classification Level Classification E-value
Superfamily Subtilisin-like 0.00482
Family Subtilases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9V7G9
Sequence length 244
Comment (tr|V9V7G9|V9V7G9_9PSED) Uncharacterized protein {ECO:0000313|EMBL:AHC90866.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_26760 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNTTPSSRINPWLSLLMAACLAFTGCASTGSSLTGGGGTADPRLTTGNDAKFFSTSGFQA
CALAAGGGILACMLSNSGNKAACSIIAGVAACGVAMGANYYLDQRRAKYADTTERLNAMT
TEVQGETAKVAERTNTLQRVINDDKEQIASIQNSIKAKTIDMAKAQQDIANIDQNISLMR
KDLNNMKTRVTEYQQVAKLERDGGASPAEVQKVEAEIAKMNTKVASLQQEVDGLYNQRSA
ITLG
Download sequence
Identical sequences A0A059UQX4 A0A2A3M272 F8FWX0 V9V7G9
WP_013970406.1.23948 WP_013970406.1.28354 WP_013970406.1.35335 WP_013970406.1.56258 WP_013970406.1.65739 WP_013970406.1.7288 gi|339485124|ref|YP_004699652.1| gi|568190339|ref|YP_008963042.1| gi|568184969|ref|YP_008957682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]