SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9V913 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9V913
Domain Number 1 Region: 26-201
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.97e-29
Family Clp protease, ClpP subunit 0.027
Further Details:      
 
Domain Number 2 Region: 375-440
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000157
Family NfeD domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9V913
Sequence length 448
Comment (tr|V9V913|V9V913_9PSED) Serine protease {ECO:0000313|EMBL:AHC90858.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_26720 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MLTRCWRWLLLLLLLGITPGGQAAPGAVWVLGIDDAIGPASADYLVRSLGQAQEQGAQLV
VIRMDTPGGLDSAMRQMIKAILASPVPVATYVAPSGARAASAGTYILYASHVAAMAPGTN
LGAATPVQIGGPPGAAKDDKAKDSDEDTLARKQVNDAAAYIRGLAQLRGRNADWAEKAVR
EAVSLSASEALQLNVIDHVADDLPDLLRKLDGKTLDVAGQPRQLQTANASLVEHLPDWRT
RVLAVITNPSVALILIMIGVYGLLFEFMNPGSTVGGVVGGICLLLALYALQLLPVSFAGV
ALILLGIAFMIAEAFVPSFGVIGFGGIVAFVIGAVILIDTDAPGFGIPLALIGTLALLSA
LLIGGVLGMALKARSRALVSGDAGLVGSLVTVTQVMAGNPFCGVVLAQGEQWQVQCATPL
QAGQNVRVTARHGVMLEVTAAAPAAQGE
Download sequence
Identical sequences F8FVR1 V9V913
WP_013970396.1.23948 WP_013970396.1.28354 WP_013970396.1.56258 gi|568184961|ref|YP_008957674.1| gi|339485114|ref|YP_004699642.1| gi|568190331|ref|YP_008963034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]