SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W0JZW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W0JZW7
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily Transposase IS200-like 5.49e-41
Family Transposase IS200-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W0JZW7
Sequence length 130
Comment (tr|W0JZW7|W0JZW7_9EURY) Transposase IS200 {ECO:0000313|EMBL:AHG02787.1} KW=Complete proteome; Reference proteome OX=751944 OS=Halobacterium sp. DL1. GN=HALDL1_03460 OC=Halobacteriaceae; Halobacterium.
Sequence
MKYNLETGSHTVYALQYHFVTVTKYRADLLTDEIAERVGEIASDISEDFGVNIQNVNGGS
DHVHILFTAKPTTDLTKFINSLKGVTSRKIRDENPEVRQALDKAFWQPGYFLTTTGQVSI
DVLMEYVEEQ
Download sequence
Identical sequences A0A220SWY2 B9LMY5 W0JZW7
gi|222476123|ref|YP_002564644.1| gi|222479556|ref|YP_002565793.1| 416348.Hlac_1129 416348.Hlac_3227 WP_009486679.1.44229 WP_009486679.1.66911 WP_009486679.1.80915 WP_009486679.1.89349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]