SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W4HA57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4HA57
Domain Number 1 Region: 5-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-60
Family Capz alpha-1 subunit 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4HA57
Sequence length 284
Comment (tr|W4HA57|W4HA57_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV87993.1} KW=Complete proteome; Reference proteome OX=112090 OS=Aphanomyces astaci. GN=H257_01385 OC=Aphanomyces.
Sequence
MADVLSDAEKLNVAKGFLLASPPGEVRDVSKDVAKLLPRGLLSDTALRGILHTYNVENSL
PVQIPNVDESKRLVVCQEGEVDVGHYLDTHGRKVWGFDHVTQEILAQDVQDASARFTSSL
EPLRAELQVEVDAYLATQFGNQGGAAVFATDSTITIVLSTERVSLRNFWSGRWKSKWTLT
NVSPDAATLAGRIDLHVHYFEDGNLQLQSHKDVAPVPVTGESLAQAVLAVLRAEEHVVHS
NLEDMYINMTEETFKEMRRVMPVTQTKMEWNLYAHRTAKDLSRK
Download sequence
Identical sequences W4HA57
XP_009822856.1.97551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]