SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4U9J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4U9J1
Domain Number 1 Region: 150-233
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.25e-23
Family Middle domain of MutM-like DNA repair proteins 0.0025
Further Details:      
 
Domain Number 2 Region: 29-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.22e-21
Family N-terminal domain of MutM-like DNA repair proteins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4U9J1
Sequence length 308
Comment (tr|W4U9J1|W4U9J1_CUTAC) Formamidopyrimidine-DNA glycosylase {ECO:0000313|EMBL:GAE77487.1} KW=Complete proteome; Reference proteome OX=1302243 OS=Propionibacterium acnes JCM 18918. GN=JCM18918_3368 OC=Cutibacterium.
Sequence
MKLSCLNSLRLFDFHDAMTTYPRGQPTVPEGHVIHRLANAIDLAFAGSRVEVTSPQGRFA
ESAAMLDGTVLASAQAWGKHLVVDFDNHRPDHLLHIHLGLIGKLAVEPTVPVVGQVRLRI
TDGVTAADLRGPQTCELINDDEWGTVAATIGPDPIRDDADPDVAWDKVRRSSRRISDVLL
DQRVAAGVGNIYRAEVLFRHRVDPATPGKQISHSTWLAMWDDLVMLMRAGVESGRIDTVQ
PEHTPEAMGRPPRVDHHGGEVYVYRREDQPVWCVIRRCGWSHREGVTCFGAHGVSVGVTD
GCWFWRSE
Download sequence
Identical sequences W4U9J1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]