SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4Z4A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4Z4A8
Domain Number 1 Region: 118-147,290-375
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.8e-30
Family Single strand DNA-binding domain, SSB 0.0011
Further Details:      
 
Domain Number 2 Region: 147-287
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.08e-29
Family BRCA2 tower domain 0.00022
Further Details:      
 
Domain Number 3 Region: 54-107
Classification Level Classification E-value
Superfamily BRCA2 helical domain 5.1e-17
Family BRCA2 helical domain 0.00043
Further Details:      
 
Domain Number 4 Region: 376-438
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000694
Family Single strand DNA-binding domain, SSB 0.018
Further Details:      
 
Domain Number 5 Region: 20-59
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000154
Family Single strand DNA-binding domain, SSB 0.003
Further Details:      
 
Weak hits

Sequence:  W4Z4A8
Domain Number - Region: 6-19
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0183
Family BRCA2 helical domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4Z4A8
Sequence length 483
Comment (tr|W4Z4A8|W4Z4A8_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_022961-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MHKWVELKYRYDREIDHSQRPALRKILERDDAASRRMVLCVAAIGNPGSSAGHDGKGAEQ
RKVGALLDTPGVDPKLLKEEWVFNHYKWIIWKAATMEVAYPLQLGGRLGLQADPRPFPLP
MTSLHPEGGTIGCLDVLILRTYPMQFMEKLPEGGSVFRNAKEEAKAAALHASRKQNKMEQ
LFTQIQKQFEAKQATKGQGGKRRRSLPSSRSRNPVEVEKLQSGEELFEAMEAAIDPAAFE
SVLSERQCSTLHAYRRLQNEVKQADLQAAFNRSLAQQNKEGKFERTVVPLMKVRVGDYNA
STSKGQQTTFLTLWRPPDDLVTELVEGKRFRISSVATSAGRNMPGMCPVQLASTRATRYE
ELPAASLKLQRSYIPRAAASMQWLGRGYTQAAYGELDAVGIVVSLDEPRSHPGSSQYHAV
YLADQDAAVMVIKFWTSPSVSSSCSDNLQRAMQPISKICSFCMQTTKYQGSVSQRLRLTL
SWT
Download sequence
Identical sequences W4Z4A8
SPU_022961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]