SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5JZF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5JZF9
Domain Number 1 Region: 21-282
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-56
Family YWTD domain 0.00000151
Further Details:      
 
Domain Number 2 Region: 635-890
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-55
Family YWTD domain 0.00000372
Further Details:      
 
Domain Number 3 Region: 334-569
Classification Level Classification E-value
Superfamily YWTD domain 1.22e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 4 Region: 938-1199
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-40
Family YWTD domain 0.0000396
Further Details:      
 
Domain Number 5 Region: 1328-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 893-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 1249-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 591-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 9 Region: 1290-1325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 288-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 11 Region: 1206-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5JZF9
Sequence length 1618
Comment (tr|W5JZF9|W5JZF9_ASTMX) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
MGAVLRSLFLCSFCLQIRAVPLLLYANRRDLRLVDAAHGRGNATVVVSGLEDAAAVDFDY
TQGLVYWSDVSEEAIKCTVLNASGPSGIQTTVVSGLASPDGLACDWLGNKLYWTDSETNR
IEVSEFDGSYRKVLFWEGLDQPRAIALDPCRGYMYWTDWGEIPKIERAGMDGTNRAIIID
TDIYWPNGLTLDYSQQKLYWADAKFNFIHRSNLDGTGREVVVKGSLPHPFALTLYEDTLF
WTDWNTHSIHSCNKHTGEERREIHSNIFSPMDIHVFSQKRQPIDVSTPCSPKNGGCSHLC
LLSPVKPFYQCACPTGVELLEDNKTCRIGATQLLLLARRTDLRRISLDTPDFTDIVLHAE
DIRHAIAIDYDPVDGHIYWTDDEVQAIRRSHLDGSDAQFIVTTQVNHPDGIAVDWIARNL
YWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVSGYMYWTDWGEFPKIERAALD
GTDREVMVNTSLGWPNGLALDYAERKIYWGDAKTDKIEVMNMNGTNRRILVEDKLPHIFG
FTLLGDYIYWTDWQLRSIERVHKHTAEREVIVDQLPDLMGLKATYVHQTFGTNPCAENNG
GCSHLCLYKPQGVACACPIGLELISDMSTCIVPEAFLLFSRHTDIRRISLETNNNNVAIP
LTGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGK
NLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGRPKIDRAA
MDGTGRITLVPNVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGLEREVIADDLPHPFG
LTQYQDYIYWTDWSQRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQGGWNACASTN
GHCSHLCLAVPVSSYVCGCPAHYSLNNDNKTCSAPTSFLLFSQKTAINRMVMDEQQSPDI
ILPIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQENGNQSMTVVSNSVGGHNLGLQPF
DLSIDIYSRFIYWTSEVTNVINVTRINGTRVGVVLRGEHDKPRAIVVNPERGYMYFTNLQ
ERSPKIERAALDGTEREVLFFTGLSKPVSLAIDNELGKLFWVDMDLRRIESSDLSGANRI
VIEDSNILQPVGLTVFGDHLYWIDRQQQMIERIDKTTREGRTKIQARISALTDIHAVHEI
DMEEYNKHPCTSDNGGCSHICIIKGDGTTSCSCPVHLVLLQDELSCGEPPTCSPVQFPCA
SGEVVCIPQAWRCDGFAECDDESDERGCPVCSEEEFQCDSKQCVDISLRCNGDINCQDRS
DENKCEGHCPPDQFACNSGQCIGKHKKCDHNMDCTDNSDEIGCYPTDEPSPQPTNTIGSI
VGVVMTLFVVGAVYFVCQRVLCPQMTDDGETMTNDFVVHGPSSVPLGYVPHPSSLSGSLP
GMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQ
YTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYTPGRRAPPVSSTAAKG
YTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences W5JZF9
XP_007256094.1.101067 ENSAMXP00000000719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]