SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5KJR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5KJR1
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.63e-48
Family Calponin-homology domain, CH-domain 0.000000484
Further Details:      
 
Domain Number 2 Region: 187-242
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000000275
Family EB1 dimerisation domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5KJR1
Sequence length 256
Comment (tr|W5KJR1|W5KJR1_ASTMX) Microtubule-associated protein, RP/EB family, member 1a {ECO:0000313|Ensembl:ENSAMXP00000007823} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
MAVNVYSTSVTSESLSRHDLLTWINSSLRMNHAKIEQLCSGAAYCQFMDMLFPSCVPLKK
VKFQAKLEHEFIFNFKILQASFKKLGVNKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPEAARQGQETATSQSPATAVANKPRKVSSSEARITSVKPTAPVAPQRSTILAPKT
APSADKEELTQMINDLKSTVTVLEQERDFYYGKLMNIERLCLEKGENVDPTLQTILSILY
ADPAEAEGDPGEPEEF
Download sequence
Identical sequences W5KJR1
XP_007231957.1.101067 XP_007231958.1.101067 ENSAMXP00000007823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]