SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5KVQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5KVQ4
Domain Number 1 Region: 689-813
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-37
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 999-1098
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-28
Family Ras-binding domain, RBD 0.0011
Further Details:      
 
Domain Number 3 Region: 19-102
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-19
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 234-374
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000231
Family Phosphotyrosine-binding domain (PTB) 0.026
Further Details:      
 
Domain Number 5 Region: 946-1013
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000238
Family Ras-binding domain, RBD 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5KVQ4
Sequence length 1385
Comment (tr|W5KVQ4|W5KVQ4_ASTMX) Regulator of G protein signaling 12a {ECO:0000313|Ensembl:ENSAMXP00000011666} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
MRVVEPPGAVRRCLDLPPSSTVRRVEMERGRAGYGFTMAGQAPCILRGIMKGSPAYSVGL
RPGDYILSVNGTDVSKASHDNVVELIGSSSCSLCLLVTSADEPFVESGSSDEELAFQINQ
TQTWLNPGKMDSSTFEKPHEKSMREPLMQSVGSFDTLFEISGQTSVNSYSKKESKQRPMS
EPDMSYWGHQSQSKCSHPHAIGMEEPTRVMSKDSVFSDFQCQNNILPDSSALNVEMVVGY
ISSMELDLVTSRSEESTIQTIRSCISRIGIEQKTHSLVMMRIKCNCVQLCDDRDVALATY
PAENLALCVICSEDNRFFCFLSMDGTKTDKNKAEESTCLKTLCHVFFIDPELYDHKEHQN
ITEHFGFSCTPDPDTQGCLEFPQTPYSIVQFVSVLYTDMGDYVEKLRLKLDSEDADESDR
NTRNSGSGDSGISNVSPEDHESLADRWSLPSPNSSGHLWDKPPPYSSRERNGKSLKVERR
CLLSEPFPAPAVPVSPQTGATTKPEGSGCAPVPTLSPVKQTNVPENPSKRRGSQRWPSVA
IRSRWQKPRPNSIESLADTDSNGLKDKNGTLPPAMEKIPTLRYRTPGDLEGPQHSLTRKL
FSSGSKNKNGDNKGSRFWGLTRGRSSVRRTAAQAKRLSLARSLDDLESAASDAERGGMER
HDCGSVSSLESNGSLPSVPNHHRLLDRRVASWAVCFERLLQDPVGVRYFSEFLKKEFSEE
NILFWQACEIFSQVPENDKKQLSQKAREIYNSFLSSKATTPVNIDSQAQLADDVLTAPRP
DMFRQPQLQIFNLMKFDSYARFLKSSLYQECMLAEVEGRPLPDPYQVPCSPAPSKHSFNS
DRSAFSTPKKDSRRARTGRSNDDLREDADRKNGIFSWYRNRSFGKGPKKREITDFTFSSN
GRRESQGSLSSSASQELNTSPGRNEFDQKTPGSTLERDRERLSRSCAVTLPDASSCCVPL
RQGASIRQVLLELCQKQHINLAAVDLFLVGGEKPLVLDQDSMTLSCRELRLEKRTLFRLD
LVPINRSVGLKAKPTKPVAEVLRPVVAKYGLRLSDLVARISGETEALDLGLPISNLDGLR
VVLERADPSSSSKDKSKTTPSKTQVPALNNKSQSTPDQGDQTSQGKAAVRGEGGNKLPIT
EASQKRKGKKIHLDEAEEFFELLSRAQSSRADDQRGLLRKEDLVLPDFLRLDPESSHPPA
CSTPTSQKPGHATNKPQPIASNGHPPRPTEPTPFTPPLSPILRPAHQSQLQDGEALGDLT
LVGEGDITSPNSTLLPPPPPPCARSHPSSALTKGVFTPVVRFSGPNQTLETHTYSKYIFS
ATSTPDRRKAVDGVSMEDSFEGYAAELRQCQSKMRSSTYPAMDPARPLSSLSENNNTIQY
KATFV
Download sequence
Identical sequences W5KVQ4
ENSAMXP00000011666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]