SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5LE28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5LE28
Domain Number 1 Region: 21-198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.4e-45
Family G proteins 0.000015
Further Details:      
 
Domain Number 2 Region: 199-237
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000209
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5LE28
Sequence length 288
Comment (tr|W5LE28|W5LE28_ASTMX) RAB40B, member RAS oncogene family {ECO:0000313|Ensembl:ENSAMXP00000018090} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
MGHRTDTSMKMSHRSSPAKAYDFLLKFLLVGDSDVGKGEILASLQDGSSESPYGYNMGID
YKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDITNRWSFDGIDRWIK
EIDEHAPGVPKILVGNRLHLAYKRQVTTENAQAFAERLGVTFFEVSPLCNFNITESFTEL
ARIVLMRHGMERLWRPNKVLSLQDLCCRSIVSCTPVHLVDKLPLPVALKSHLKSFSMANG
LNARMMHGRSYSVIASSAKKRNGTKKSKLIYPPLSPSQSCARTSCKIS
Download sequence
Identical sequences W5LE28
ENSAMXP00000018090 XP_007259403.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]