SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5M012 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5M012
Domain Number 1 Region: 271-400,438-507
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.76e-38
Family Hemopexin-like domain 0.0011
Further Details:      
 
Domain Number 2 Region: 64-105
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000418
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 25-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000379
Family Somatomedin B domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5M012
Sequence length 507
Comment (tr|W5M012|W5M012_LEPOC) Proteoglycan 4a {ECO:0000313|Ensembl:ENSLOCP00000001719} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
QVYSFKTVVVAFLTKPSFVTLGTTSSCNDRCGESYYRGDICHCDYDCLLHKECCSDYEAF
CTTVDSCKGRCGETFQRGKQCYCDVECSRYNQCCPDYRKHCTIEAKIPDGTVSTETTPPA
KVQKLLDSTLTNPFVLNDEVKPSAVTAQTPVATEDLAKSTVSPVPDDEVKLPAVTPQSPV
GTEDLAKSTMSPEPENIASQTTAHNGVPSSVSVEGIKDMFTLTHTSVHTSLPEPSERHIP
VPSTSSGTVTIQSTVPSKHPSDSVGENNDTNICSGRPANALTTLQNGTMIVFRGHFFWTF
GSNGALGHPRRITEEWGIPSPIDTVFTRCNCQGKTFIFKANEYWRFDNGVMDRGYPKLIS
KGFGGMSGRITAALSVPAFGKRREAVYFFKRGGLVQKYSYKQEPSQSCGKPQTQYRIYSL
HSRITRQAGPVYLGKEINIKLTWKGFPTSVTSAISLPNSKKPDGYDYFVFSRAKYYNIII
NSDQPAVTPLLKSVTHKDTAKDWYHCP
Download sequence
Identical sequences W5M012
ENSLOCP00000001719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]