SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5M1Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5M1Q0
Domain Number 1 Region: 635-732
Classification Level Classification E-value
Superfamily TAFH domain-like 1.31e-35
Family TAFH domain-like 0.0000405
Further Details:      
 
Domain Number 2 Region: 890-938
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000753
Family TBP-associated factors, TAFs 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5M1Q0
Sequence length 1106
Comment (tr|W5M1Q0|W5M1Q0_LEPOC) Si:dkey-219c3.2 {ECO:0000313|Ensembl:ENSLOCP00000002308} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MAGASDPLEDMLFSEVDEKAVSDLVGSLESQLAGQSNPAAPHTETRSAGVTGAANHHLGR
MLPAQVDTILEQQQQQQGQHKAGVNQEPNCKALSSGKTVIPSSLSSIPPFEEASITSGTG
VNASSSGLPSHGASNITTVSAPGLVTLPPPLVSISPGSRGTVLGSGGAATAADPLKNHLT
STIRTAPAGIQSLNGNGGVAVNSPVNPAAPAAVGFPAAAGAVTLVNNVVNSAVPSPTGAA
SSGLAGAPCASAPAFSAAQPGVAPDGSGTLTIALQRPPGHLAASVAQNGNGAPALVQQVA
RTGPPAAAVAQLANHRKGGDGSDPPADSPAPSKIILPTQPCVVSSLANPVSSPAPAVNPP
ASQPPSSAASSAPAASSPAAKPAVNITTVGVVRPGTPSPSAGMSASTQPQPLRPGVGATQ
RIVAPQLIVRPPQQTTIQLPPGFTIPPGMVLVRTEMGQLVMVPQQALAQAQAQAQAQAQA
QAQAQAQAQAQAQAQAQAQAQAQAQGQAHNSISPRPAAPTSGPTFRVTTTQSPVSSPAIR
PCPPVQAKIVQPPTPSASPALQVSSSVAPTKAAVVTAAVATAAAQQPLTVIAGGQNPPQA
QPQPAPQPALAQQGAAPTALASAPAPGASVVSQEMQENVKKCKNFLATLIKLASHNSPSP
ETSRNVKALVQDLLDAKIEPEEFTNRLQSELKSSPQPYLVPFLKKSLPALRQSLLNSQQS
LMQTQQPLQQVKPAPGTPQATAGTVPTIVAGPTVRVRHPNSVGNTVPSILPHAPGTAHTS
HLAIKRAPGVQSSQVRMPMVITQTVRPQGTVGKAPTIQASKGPGGFAVQVSANQKNKLND
PGGGSFRDDDDINDVASMAGVNLNEESARILATNSDLVGTQIRSCKDEAFLPSGLLHKRI
LETAKKFGVTEVPAEAVNFISHATQERLRTVLEKVTIIAQHRMETYKDDEWYEQATDVRS
QLKFFEQLERIEKQRKDEEEREILLKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQR
DANLTALAAIGPRKKRKLDSPGAAPPGAEVSGSSSGSPAGSATPAASSRQYPRQRITRVS
LRDFIFYMEQERETAHSLLLYRALLK
Download sequence
Identical sequences W5M1Q0
ENSLOCP00000002308 XP_015223837.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]