SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5NIC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NIC0
Domain Number 1 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000125
Further Details:      
 
Domain Number 2 Region: 633-891
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-54
Family YWTD domain 0.00000392
Further Details:      
 
Domain Number 3 Region: 332-567
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-50
Family YWTD domain 0.00000406
Further Details:      
 
Domain Number 4 Region: 939-1198
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-42
Family YWTD domain 0.0000363
Further Details:      
 
Domain Number 5 Region: 1329-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1250-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 7 Region: 894-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family EGF-type module 0.018
Further Details:      
 
Domain Number 8 Region: 588-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000351
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1291-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 10 Region: 284-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000007
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1208-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000513
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5NIC0
Sequence length 1615
Comment (tr|W5NIC0|W5NIC0_LEPOC) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MGAVLRSLLLCSFCSVIRGAPLLLYANRRDLRLVDAARGQGNATVVVSGLEDAAAVDFVY
SKGLIYWSDVSEEAIKRIVFNQSGSVHSVVVSGLVSPDGLACDWLGSKLYWTDSETNRIE
VSNLDGSLRKVLFWQDLDQPRAITLDPARGYMYWTDWGEVPKIERAGMDGTNRSIIIDRN
IYWPNGLTLDYIEKKLYWADAKYNFIHRSNLDGTSREVVVEGSLPHPFALTLFEDTLYWT
DWNTHSIHSCNKTSGSNRREVHTNIFSPMDIHVFNQKRQPALANNPCGENNGGCSHLCLM
SPVKPFHQCACPTGVQLLGDGKTCKDGASELLLLARRTDLRRISLDTPDFTDIILNLDDI
RHAIAIDYDPVEGHIYWTDDEVHAIRRSYLDGTGSQFLVTSQVNHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPMSGYMYWTDWGEIPKIERAALDGT
DRVVMVNTSLGWPNGLALDYAEKKIYWGDAKTDKIEVMSMDATGRRILVEDKLPHIFGFT
LLGDFIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCADENGGC
SHLCLYKPQGVQCACPIGLELISDMSTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMD
GTGRITLVPNVGRANGLTIDYAERRLYWTDLDTTLIESSNMLDGAGQEREVIADDLPHPF
GLTQYQDYIYWTDWSQRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQGGWNACAST
NGHCSHLCLAVPVSSFVCGCPAHYSLNSDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPD
IILPIHSLRNVRAIDYDPLDKHLYWIDSKQNVIRRAQEDGNQSMTVVSSAVTSHGLGMQP
HDLSIDIYSRFIYWTNEITNVINVTRTDGRRVGVVLRGEQDRPRAIVVNPERGYMYFTNL
QDRSPRIERAALDGTEREVLFFTGLGKPVALAIDNELGKLFWVDSDLRRIESSDLSGADR
IVIEDSNILQPVGLTVFGNHLYWIDRQQQMIERIDKVTREGRTKIQARIASLSDIHAVSE
LDMREYRKHPCTLENGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSC
SSGDVDCIPQAWRCDGYPECDDGSDEEDCPVCSDTQFQCDSRQCVDIIMRCNGEINCQDK
SDENKCEVLCPVDQFMCSNGQCIGKHKKCDHNTDCTDNSDELGCYPTEEPSPQPTNTIGS
IIGVILALFVVGAMYFVCQRVLCPHMKDDGETMTNDFVVHGASSVPLGYVPHPNSLSGSL
PGMSRGKSVMSSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERS
HYTLEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYTPSRRIITAAKGYTS
DLNYDSEPFPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences W5NIC0
ENSLOCP00000020379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]