SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5NUH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NUH4
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily dUTPase-like 1.23e-20
Family dUTPase-like 0.00063
Further Details:      
 
Domain Number 2 Region: 119-205
Classification Level Classification E-value
Superfamily Acid proteases 1.3e-18
Family Retroviral protease (retropepsin) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5NUH4
Sequence length 205
Comment (tr|W5NUH4|W5NUH4_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000001818} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN= OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
PDSVGLDLSSATATILTPDVPVSLIPKGMAGPLPEGIVGLVLVCSLLSLQGISVVPGVVD
SDYTGEIKVLISLPAKTVQISKGQRIAQLLLLPYYQIRRTLTSQARGPRGFRFSDLAFWV
QEITPSRPLKDLLIQGNRTSGLLDTGADISCFAGKDWPSSWPTHLTNAGLVGIGSVPSVA
KSSQILTWSDVIPSLPFSLWGIDIL
Download sequence
Identical sequences W5NUH4
ENSOARP00000001818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]