SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5NVZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NVZ7
Domain Number 1 Region: 173-317
Classification Level Classification E-value
Superfamily TPR-like 4.4e-22
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 2 Region: 6-93,131-157
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000000114
Family FKBP immunophilin/proline isomerase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5NVZ7
Sequence length 328
Comment (tr|W5NVZ7|W5NVZ7_SHEEP) Aryl hydrocarbon receptor interacting protein like 1 {ECO:0000313|Ensembl:ENSOARP00000002343} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=AIPL1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MDATLLLNVEGIKKTILHGGTGDLPNFITGARVTFHFRTMKCDEERTVIDDSKQVGHPMH
IIIGNMFKLEVWEILLTSMRVSEVAEFWCDTIHTGVYPILSRSLRQMAEGKDPTEWHVHT
CGLANMFAYHTLGYEDLDELQKEPQPLIFIIELLQVEAPSQYQRETWNLNNHEKMQAVPI
LHGEGNRLFKLGRYEEASNKYQEAIVCLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCL
LKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLEKVLELEPSMRKA
VQRELRLLENRLEEKREEERLRCRNMLG
Download sequence
Identical sequences W5NVZ7
ENSOARP00000002343 XP_004012634.1.66739 XP_012002347.1.54773 XP_017919535.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]