SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5P775 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P775
Domain Number 1 Region: 61-543
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.19e-130
Family Pyridoxal-dependent decarboxylase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5P775
Sequence length 543
Comment (tr|W5P775|W5P775_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000006279} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=LOC101117810 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MDLEECGYSLANKKQMRKKSIHACQSTDKDVIKEAHAENLMTNLSNAYASDLLPSKEGED
LTKCFLLRVVNILLHYIEKTFDVKSKILDFHHPHQLLEGLDGFDLELSDHPESLEQLLVD
CTDTLKYGVKTGHPRYFNQLSSGLDVIGLAGEWLTATANTNMFTYEIAPVFTVMETVLLK
KMCEIIGWRETEADGIFSPGGSISNLYGILVARYKQYPEIKARGMAVLPCIVLFVSEQGH
YSIRKAAATLGIGTDNVIEVKCDERGKMIPAELEKNILQAKRKGQTPFCVVATAGSTVFG
AFDPLHDIADICEIHRLWMHVDAAWGGGLLLSRTHSYKLSGIERADSVTWNPHKLMGVPL
QCSALLTREKGLLGACNQMQAEYLFQPDKVYNINFDTGDKTIQCGRHVDVFKLWLMWKAK
GTYGFEVQIDRYMELAKYFYKVLKKKDNFKLVFDAEPEFTNVCFWYFPPRLKHIPESFER
DQELQKIAPKIKAQMIVEGTVMLSYQPCGDKVNFFRMVFSNPATRQTDVDYLIDEIQRLG
KDL
Download sequence
Identical sequences W5P775
ENSOARP00000006279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]