SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5P880 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P880
Domain Number 1 Region: 926-1060,1120-1186
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.41e-40
Family Hemopexin-like domain 0.00077
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000126
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000275
Family Somatomedin B domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5P880
Sequence length 1186
Comment (tr|W5P880|W5P880_SHEEP) Proteoglycan 4 {ECO:0000313|Ensembl:ENSOARP00000006635} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=PRG4 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MEWKILPIYLLLLSVFLIQQASSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFK
KECTVELSCKGRCFESFARGRECDCDSDCKKYGKCCSDYGTFCEAVHNPTPPPPPKTAPP
PPGASQTIKSTTKRSPKSPNKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSTIRKIK
SSKNSADNRELKKKPKVKDKKKRTPKNKPTLEPPVIDEGGSGLDNGDFKLTPTPIIPTTQ
RNKVTTTPKITTVKPTLPKPSLPPNSDTTKEIPSTVRETTVETKETSTTSKQTSTSAKEK
TTSAKETRTAENTSTKGLAPTPEAPATSTPKAKTITRSPTPTTPKKPTPTTKEPAPTTTT
TKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEP
APTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTT
TKEPAPTTTXPPPTPQAPAPTPTKEPPPTTPKEPAPTTPKEPAPTAPKEPPAPTTTAAAP
APTTAPDAPPTPPKEPVPTTPKKPAPTIPEEPAPTTPKEPAPTSPKEPAPTTTPKEPAPT
TPKEPAPTIPKEPAPAKPKEPTPNFPETPAPSSPDIPAPTTSKASTSTTAMQPATTPKSP
AESTPQPPIEPTPKALGKSPKEPAVPTIKAPKVNKPEMTTTVKDKSTEEDIHPTPEITTA
VAKIVTEAATKTEKTTESKTPSTTTGVTSTTTKQTTSSKITPKTTLAPKVMTATKTTTKK
TANKPEKTTAVPKGTATNSQVTTPKPQKPTKAPKKPTSTKKPTPRVRKPKTTPTPPKMTS
VMPEPTPTSLPEAMLQTTTSPTPTPNSEIIEVNPKNEDGDAAEGEKPHVIFRPPVLTPIV
IPGTEIIVRGHGQGFGINPMFSDETNLCNGRPVDGLTTLRNGTLVAFRGHYFWMLTPFSP
PPPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKGSQYWRFTNDIKDAGYPKLISKGFGG
LNGKIVAALSIAQYKNRPESVYFFKRGGSVQQYTYKQEPTQKCTGRRPAINYSVYGETAQ
VRRRRFERAIGPSQIHTIRIHYSPVRVPYQDKGFLHNEVKVSTLWRGLPNVVTSAISLPN
VRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSNTWYKCP
Download sequence
Identical sequences W5P880
ENSOARP00000006635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]