SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5P8H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P8H9
Domain Number 1 Region: 101-513
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-119
Family Pyridoxal-dependent decarboxylase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5P8H9
Sequence length 567
Comment (tr|W5P8H9|W5P8H9_SHEEP) Sphingosine-1-phosphate lyase 1 {ECO:0000313|Ensembl:ENSOARP00000006734} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SGPL1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
EQTSFLSLKAFEPYFEILEVYSTKAKNYVNGHCTKYEPWQLIVWSVVWTLLIVWVYEFVF
QPESLWSRFKKRCFKLIRKMPVIGRQIQDKLNKTKEDISKNMSFLKVDQDYVKALPPQGL
SPAAVLEKLKEYSSKDVLWQEGKASGAVYSGEKELTDLLVKAYGDFAWSNPLHPDIFPGL
RKIEAEIVRMACSLFNGGPDSCGCVTSGGTESILMACKAYRELAFENGIKTPEIVAPQSA
HAAFDKAASYFGMKIIRVPLNKMMEVDVRAMRRAISRNTAMLVCSAPQFPHGVIDPIPEV
AKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEQPFDFRVKGVTSISADTHKYGYAPKGS
SVVLYSDKKYRRYQFFVATDWQGGIYASPTIAGSRPGGISAACWASLMYFGESGYVEATK
QIIKTTRFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLFNLMHAKGWNLNQLQFPP
SLHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATVDRNLVAEL
SSVFLDSLFSTDTVAQGSQMNGSPKPR
Download sequence
Identical sequences W5P8H9
ENSOARP00000006734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]