SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5P9J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P9J3
Domain Number 1 Region: 66-155
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.77e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5P9J3
Sequence length 627
Comment (tr|W5P9J3|W5P9J3_SHEEP) Neuronal PAS domain protein 3 {ECO:0000313|Ensembl:ENSOARP00000007101} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=NPAS3 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHALPPPTINEV
RIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEGIRHSHLDLL
NKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPEYKDTPMDIA
QLPHLPEKTSESSETSDSESDSKDTSEDNENSKSDEKGNQSENSEDPEPDRKKSGNTCDN
DMHCNDDGHSSSNPDSRDSDDSFEHSDFENPKAAEDGGGGGFGALGRMQIKVERGYVESE
SDLRLQDCESLSSDSGTAMAPATAPATRTAATATTASSIRTLRTPRRPRTASGAASARRR
RLPSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREISR
NESPYSMTKPPSSEHFPSPLGVGAARLGAVVCAARRVAPDTPREGGGGHRNGGGGPGAAN
SLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQG
NLLPNAHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGAAGLTQMPAGNVFTTA
EGLFSTLPFPVYSNGIHAAQTLERKED
Download sequence
Identical sequences W5P9J3
ENSOARP00000007101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]