SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5PF65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PF65
Domain Number 1 Region: 357-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.81e-133
Family Transferrin 0.0000000000928
Further Details:      
 
Domain Number 2 Region: 22-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.06e-129
Family Transferrin 0.000000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PF65
Sequence length 704
Comment (tr|W5PF65|W5PF65_SHEEP) Transferrin {ECO:0000313|Ensembl:ENSOARP00000009080} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=TF OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MRPAVRALLTCAVLGLCLADPEKTVRWCTISTHEANKCASFRENMLRIFENGPFVSCVKK
TSHMDCIKAISNNEADAVTLDGGLVYEAGLKPNNLKPVVAEFHGTKDNPQTHYYAVAVVK
KGTDFNLNELKGKKSCHTGLGRSAGWNIPMGRLYKELPDPQESIQRAAASFFSASCVPCA
DQSSFPKLCQLCAGKGTDKCACSNHEPYFGYAGAFKCLAEGSGDVAFVKHSTVFDNLPNP
DDRKDYELLCGDNTRKSVDDYHGCHLAKVPSHAVVARTVGGKEDVIWELLNHAQEHFGKD
KPDNFQLFQSPHGKDLLFKDSADGFLKIPSKMDFELYLGYEYVTALQNLRESKPPDTSTD
ECKVKWCAIGHQERTKCDQWSGFSGGAIECETAENTEECIAKIVKGEADAMSLDGGYLYI
AGKCGLVPVLAENYETEGTDCKDTPEKGYLAVAVVKASDADLNWNNLKGKKSCHTAVDRT
AGWNIPMGLLYSKINNCKFDEYFSAGCAPGSQRNSSLCALCIGSEKGSGKECVPNSNERY
YGYTGAFRCLVEKGDVAFVKDQTVKQNTDGNNGEEWAKDLKKGDFELLCKDGTRKAVGDA
ENCYLARAPNHAVVSRKDKATCVERILKEQQANFGKAVTDCTSNFCLFQSTSKDLLFRDD
TKCLASIAKKTYDSYLGDDYVRAMTNLRQCSTSKLLEACTFHKP
Download sequence
Identical sequences W5PF65
ENSOARP00000009080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]