SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5PJY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PJY0
Domain Number 1 Region: 28-227
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000408
Family Quinoprotein alcohol dehydrogenase-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PJY0
Sequence length 1007
Comment (tr|W5PJY0|W5PJY0_SHEEP) ER membrane protein complex subunit 1 {ECO:0000313|Ensembl:ENSOARP00000010751} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=EMC1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MAAAAASRLWLWAALLIPAAAVYEDQVGKFDWRQQYVGKLKFASLEFSPGSKKLVVATEK
NVIAALNSRTGEILWRHVDKGTAEGVVDAMLLCGQDAITVSNGGRIMRSWETNIGGLNWE
VTLDSGSFQALGLVGLQEAVRHIAVLKKTTLALHHLSSGHPKWVEHLPESDSIHYQMVYS
YGSGAVWALGVVPFSHVNVVKFNVDDGEIIQQVRVSTPWLRSLAGACGVVDEAVLVCPDP
SSQSLQTLALETEWELRQTPLQSLDLEFASGFQPRVLPTQPSPVDPSRAQFFLQLSPSHY
ALLHYRHGVLSLLKNFPQAALVSFATTGEKTVAAVMTCRNEAKPSVSEDGSPGSFSEKSG
SQDSLACFNQTYTINLYLVETGRRLLDTAITFSLEQNGTRPERLYIQVFLKKDDSVGYRA
LVQTEDHLLLFLQQLAHHFSFWPKMGVAPLAEVVCGEVGALPLTGAQAELEGEFGKKADG
LLGMFLKRLSSQLILLQAWTSHLWKVFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMV
TASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLLKDKETGMS
SLYVFNPIFGKWSQVAPPVLKRPVLQSLLLPIMDQDYAKVLLLIDDEYKETVKSLEKSML
RDSFSFNPSIFFYLVDADQGRLCGYRLRKDLTTELSWELTIPPKEQPLRQRATGAWASWT
PGGRGARIGLWRSLNPNLLAVVTESTDAHHERAFIGIFLVDGVTGRIIHSSVQRKAKGPV
HIVHAENWVAYQYWNTKARRNEFTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFPS
AISAMEATITERGITSRHLLVGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDV
QIHAERFINYNQTVSRMRGIYTAPSGLESTCLLRRGLRYGLDIYQTRVYPSKQFDVLKDD
YDYVLISSVLFGLVFTTMITKRLAQVYLESLLLASKVRGNTCDNSTL
Download sequence
Identical sequences W5PJY0
ENSOARP00000010751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]