SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5PM58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PM58
Domain Number 1 Region: 15-427
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-108
Family ALDH-like 0.000000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PM58
Sequence length 482
Comment (tr|W5PM58|W5PM58_SHEEP) Aldehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR036492} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN= OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
VSGAEDRLWSTRSSGFARCSSHPLTFRQRQLKALRAMVQEREKDILAAIGADLSKSEFIA
YSQEVISVLGEIDLMLEKLPDWAAAKPAQRNLLTMLDEAYIQPGPLGVILIIGAWNYPFV
LTIQPLIAIAAGNAVIIKPFEVSENTTKLLAKLLPQYLDQDLYAVVNGGVEETTELLKQQ
FDHILYTGNTAVGKIVMQVAAKHLTPVTLELGGNSPCYVDRDCDLDVACRLITWGKFMNC
GQTCIASHYVLCESSLQDLIVPKVQEAVKEFYGENVKESPDYKRIVNLRHFKRIKSLLEA
FSGEMDEATRYIAPTILTDVDPDTKVMQEEIFGPILPIVPVKNADEAIQFINEREKPLAF
YMFSHNSKLIKQMIDGDTSGGVTGNEVIMYFMLSSLPFRGVGSSGMGAYHGKHSFDTFPY
QHPCLLKTLKQEGANQLQYPPNSQSKVGWAKLFLLKRFNKGRLGLLLFTLLGVLATMLIK
AG
Download sequence
Identical sequences W5PM58
ENSOARP00000011533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]