SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5PQ41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PQ41
Domain Number 1 Region: 334-410,532-647
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.65e-43
Family Phosphate binding protein-like 0.000000507
Further Details:      
 
Domain Number 2 Region: 5-244
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.35e-17
Family L-arabinose binding protein-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PQ41
Sequence length 726
Comment (tr|W5PQ41|W5PQ41_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000012568} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN= OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
QEKGSTFLQLGSSTEQQLQVIFEVLEEYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVG
WEHRGALTLDPGAGEAVLGAQLRSVSAQIRLLFCAREEAEPVFRAAEEAGLTGPGYVWFM
VGPQLAGAWGSVGSVKYLIEIHGPGYQETPTSGIEASSSILATLSSTSPSLSLPVPTEGH
KGPFFKKRTFSKYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLR
LKYPLWSRYGRFLQPVDDTQHLTVATLEERPFVIVEPADPLSGTWLGTCIRDSVPCRSQL
NRTHRTQEFPFQNPRLQSPAVLAPQTPPPLGPGKSHGKKIDGVWNGMIGEVFYQRADMAI
GSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVV
AVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKI
MVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGS
TEKNIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVT
IGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMS
SKLDIDNMAGVFYMLLVAMGLSLLVFAWEHMVYWRLRQCPGPTHRTGLRIASPRYDAAWE
APPPPR
Download sequence
Identical sequences W5PQ41
ENSOARP00000012568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]