SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5PU89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PU89
Domain Number 1 Region: 25-483
Classification Level Classification E-value
Superfamily ALDH-like 2.82e-68
Family ALDH-like 0.00000731
Further Details:      
 
Domain Number 2 Region: 520-762
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-41
Family ALDH-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PU89
Sequence length 807
Comment (tr|W5PU89|W5PU89_SHEEP) Aldehyde dehydrogenase family 16 member A1 {ECO:0000256|PIRNR:PIRNR036490} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ALDH16A1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MAATRTASRAGEIFTTLEYGPAPESHACALAWLDTQDRHLGHYVNGQWLKPEHRSSVPCQ
DPITGENLASCLQAQSEDVAAAVEAARASLENWSTQPGAFRAQHLTRLAKAIQKHQRLLW
TLESLVTGRAVREVRDRDVPLAQQLLQYHAVQVLAAHQEEALAGWEPMGVIGLILSPTFP
FLDMMWRICPALAVAPGCTVVVLAPASPTPLLLAQLAGELGPFPGILNVISGPASLGPVL
AGQPGVLQGALWGVEEGRALRRHEQGRALGDESLLLLTEVADVDSAVEGIVDAAWSDRSR
FNFQFFMAPNPFIFTPLPLKFLSLHVPTSPGPDGAVDMGARGDAARDLAQRYVREAQSQG
AQVFQAGSVPSDSPFFPPTLVSDLPPASPCTQAEVPWPLVVASPFRTAKEALAVANGTPR
GGSASVWSERLGQALELAYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGQDGLYEY
LRPSGTPAWIPYLSKTLDYDSFGLALPSALPAGPETGPAPPYGLFVGGRFQAPGARSSRP
IRDSQGSLLGYVAEGGAKDIRGAVEAAHQAAPGWMSQSPAARAALLWALAAALQRREPNL
VSRLERHGVELKVAKVEVELSVKRLRAWGARVQAQGCALQVAELRGPVLRLREPLGVLAI
VCPDEWPLLAFVSLLAPALAHGNTVVLVPSGASPIPALEVCQEMAALLPAGLVNVVTGDR
DHLTRCLALHQDIQALWYFGSAQGSQFVEWASAGNLKPVWVNRGCPRAWDQEAEGAGPEL
GLGGPRATARIAQHSHSISDREDMDPN
Download sequence
Identical sequences W5PU89
ENSOARP00000014020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]