SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5PZS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PZS8
Domain Number 1 Region: 153-232
Classification Level Classification E-value
Superfamily TAFH domain-like 2.49e-30
Family TAFH domain-like 0.00000991
Further Details:      
 
Domain Number 2 Region: 557-604
Classification Level Classification E-value
Superfamily Histone-fold 2.8e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PZS8
Sequence length 770
Comment (tr|W5PZS8|W5PZS8_SHEEP) TATA-box binding protein associated factor 4 {ECO:0000313|Ensembl:ENSOARP00000015964} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=TAF4 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
IPDTSPLPRPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQTTMAPRPATPTSAPP
VQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSTALQRSPGVQTDIPPGKPPQLVL
GGAAQTTSLGTATAVQTVTPQRTVPGATTTSTAATETMENVKKCKNFLSTLIKLASSGKQ
STETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKVSRPPLLLPQCRVA
PEDPEGPCPLRGRPVCPRLKGAALLGGRCRSDASAALNVRGRLQPPVISLTQPTQPGVVF
SQEPWPKHTEPTQVLSVGHVSFHGLGPSSAAVVWGLEIPRFAAADGGLVCGSDPGSGCAA
VEKASLLEPAPAAYRQNNGGLCVTFPSLMVREMGSTGRPGPWAGDGCRQPPWGWGCVLTR
PAGSLQVIQPPPKPGALIRPPQVTLTQTPMVALRQPHNRIVLTTPQQIQLNQLQPVPVVK
PAVLPGTKALSTVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILAT
NSELVGTLTRSCKDETFLLPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVE
KISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSR
QEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGPEGSGPG
SAVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences W5PZS8
ENSOARP00000015964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]