SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5Q9M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q9M1
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-130
Family ALDH-like 0.0000000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5Q9M1
Sequence length 509
Comment (tr|W5Q9M1|W5Q9M1_SHEEP) Aldehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR036492} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ALDH3A2 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MEREVQRVRAAFGSGRSRPLTFRRRQLEALRAMVQEREKDILAAIGADLSKSEFNAYSQE
VISVLGEIDLMLEKLPEWAAAKPAQRNLLTMLDEAYIQPEPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSEVSENTAKLLAKLLPQYLDQDLYAVVNGGVEETTELLKQRFDH
ILYTGNTAVGKIVMQAAAKHLTPVTLELGGKSPCFVDRDCDLDVACRRIAWGKFMNCGQT
CIAPDYVLCEPSLQDQIVRKVQEAVKEFYGENVKESPDYERIVNLRHFKRIQSLLEGQKI
AFGGEMDEATRYIAPTVLTDVDPDTKVMQEEIFGPILPIVPVKNADEAIQFINEREKPLA
FYVFSHNSKLIKRMIDGTSSGGVTGNDVIMHFMLSSLPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKTLKREGANQLRYPPNSQSKVDWAKFFLLKRFNKGKLGLLLLTLLGVLAAVLI
KRYQAVLRTKALLLFLAVHRRAIPNSGQR
Download sequence
Identical sequences W5Q9M1
ENSOARP00000019413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]