SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5QBV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QBV3
Domain Number 1 Region: 5-419
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4.36e-163
Family Phosphoglycerate kinase 0.00000000000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5QBV3
Sequence length 420
Comment (tr|W5QBV3|W5QBV3_SHEEP) Phosphoglycerate kinase {ECO:0000256|RuleBase:RU000532} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=PGK1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKYCLDSGAKSVVL
MSHLGRPDGVPMPDKYSLQPVAVELKSLLGKDVLFLKDCVGPEVEKACADPAAGSVILLE
NLRFHVEEEGKGKDASGNKVKAEPTKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPKKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLISNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGTSLFDEEGSKIVKDLMSKADKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPVGWMGLDCGPESSKKYAEAVARAKQIVWNGPVGVFEWEAFARGTKALMDEVV
KATSRGCITIIAGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEETGKVLPGVDALSSV
Download sequence
Identical sequences W5QBV3
ENSOARP00000020200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]