SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5QI86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QI86
Domain Number 1 Region: 630-885
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 17-278
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-56
Family YWTD domain 0.00000191
Further Details:      
 
Domain Number 3 Region: 329-575
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 933-1192
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-39
Family YWTD domain 0.0000435
Further Details:      
 
Domain Number 5 Region: 887-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 585-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 1245-1283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1323-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000142
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 1285-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 281-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000479
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1202-1255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000542
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5QI86
Sequence length 1611
Comment (tr|W5QI86|W5QI86_SHEEP) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=LRP6 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
IVVLTISAGLIFVLAAPLLLYANRRDLRLVDAANGKENATIVVGGLEDAAALDFVFSHGL
IYWSDVSEEAIKRIEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNL
DGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSDRFVIINTEIYWP
NGLTLDYEERKLYWADAKLNFIHRSNLDGTKVTRQAVVKGSLPHPFALTLFEDTLYWTDW
NTHSILACNKYTGEGLREIHSNIFSPMDIHVFSQQRQPNATNPCGIDNGGCSHLCLMSPV
KPFYQCACPTGVTLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHA
IAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDT
GTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRV
VLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLG
DYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEDNGGCSHL
CLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLSGVK
EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWA
DTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSE
RTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQ
DYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSH
LCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIH
SLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSID
IYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPK
IERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDT
NILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEY
RQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELLCGEPPTCSPQQFTCFTGEID
CIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNC
EVLCLIDQFRCANGQCIGKHKKCDHNLDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIV
TIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRG
KSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEF
GYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVVTAKGYTSDLNY
DSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences W5QI86
ENSOARP00000022438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]