SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7UX31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7UX31
Domain Number 1 Region: 320-575
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.67e-53
Family BadF/BadG/BcrA/BcrD-like 0.00017
Further Details:      
 
Domain Number 2 Region: 5-257
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.4e-51
Family BadF/BadG/BcrA/BcrD-like 0.00049
Further Details:      
 
Weak hits

Sequence:  W7UX31
Domain Number - Region: 746-846
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0759
Family Capz alpha-1 subunit 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7UX31
Sequence length 989
Comment (tr|W7UX31|W7UX31_RUMFL) 2-hydroxyglutaryl-CoA dehydratase {ECO:0000313|EMBL:EWM52967.1} KW=Complete proteome; Reference proteome OX=1341157 OS=Ruminococcus flavefaciens 007c. GN=RF007C_15245 OC=Ruminococcus.
Sequence
MANKYSLGIDVGSTTVKTVITDADGNIVYSKYQRHLSKVKETVTDQLKIIQADYPDETFT
VCITGSAGLGLANSAGIPFVQEVHAAFLAVKKKQPDADAVIELGGEDAKIIFLTGGVEQR
MNGTCAGGTGAFIDQMATLLGITADQLDELSLHAQKIYPIASRCGVFAKSDIQPLLNQGA
RREDVAASIFQAVVDQTVSGLAQGRTIEGKVLFLGGPLFFLSGLKKAFKKTLGLDDDNAM
FPPEAPVFVAYGCAIYAAAAGDSFHIEDIIDKIRTAKASDDIVTGEPLFRSQAEYEGFID
RHRKFDLGYADIHTYKGDAYLGIDAGSTTTKLVLITDDGRILYHHYSSNQGQPLDKVSDQ
VRRIYSEMNPGITIKGSAVTGYGEDLIKAGLSIDHGIVETVAHFKAAAYFCPDVDFIIDI
GGQDIKCFKIKNKSIDSIMLNEACSSGCGSFIQTFAMALGYDIAEFSQLGLFAEHPVDLG
SRCTVFMNSSVKQAQKDGATVDDISAGLSSSIIKNAIYKVIRANSPDDLGKNIVVQGGTF
LNDAVLRSFEKELGRNVIRPAISGLMGAFGCALYAKERAGDEPSKIISAEELENFTYTSR
SANCGGCTAHCQLNIINFGKGRRFISGNRCEKGGGMANKNTVPNLYEFKYDSILNTVKTH
QPRRYRGTVGLPLALGFYEQLPFWHMLFTTLGFRTVISDESSRDMYYLGQHTIPSDTVCY
PAKLTHGHIENLLDKGVDFIFYPCMSYNIDEGNSDNHFNCPVVAYYPELLIANNPRLNNE
NFIHPYMDLNIRKNVIKVMGQALKNYNVKGRIPEAVDKAYEALQTYRNSVTRKAMEIITQ
ARAEGRKIIVIAGRPYHIDKEINHGIHKLVSSLGMAVITEDSIAGLASTPKLGVLNQWTY
HSRLYRAAKYVTTQPDMQLIQLVSFGCGIDAVTGDEVRHILESRGKLYTQLKIDEINNLG
AARIRLRSLVAAMEQADQKPAKKPVVQPV
Download sequence
Identical sequences W7UX31
WP_037300136.1.36227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]