SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549456175|ref|YP_008604934.1| from Aeropyrum camini SY1 = JCM 12091

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549456175|ref|YP_008604934.1|
Domain Number 1 Region: 5-171
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.9e-35
Family GHMP Kinase, N-terminal domain 0.0006
Further Details:      
 
Domain Number 2 Region: 180-319
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.98e-30
Family Mevalonate kinase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549456175|ref|YP_008604934.1|
Sequence length 324
Comment mevalonate kinase [Aeropyrum camini SY1 = JCM 12091]
Sequence
MREAASASAPGKVIIVGEHFVVRGSMAIVTAIGRRLRVTVESGGDGIVLESSMLGRHHAP
LPGQGTAASVSTVLEPYMAVLRSLAARGYSVVPHRILVESKIPPRAGLGSSAASMVAYAL
AYSAMHGDPLSEEELYSVAMEGERIAHSRPSGVDVTIAVKGGVLAYKRGEEPVRLEQRLA
GVTLLIADTGIERQTRDVVEHVLSVAESLGEASNHIYTAADVISREARGAIERGDAERLG
LLMNAAQGLLSALGASSLEIETLVYRMRRAGALGSKLTGAGWGGCVIGLFREEEAESGLR
SVTGDAAQAFTASMAEEGAKLETL
Download sequence
Identical sequences U3TG32
gi|549456175|ref|YP_008604934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]