SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549456165|ref|YP_008604924.1| from Aeropyrum camini SY1 = JCM 12091

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549456165|ref|YP_008604924.1|
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000137
Family GHMP Kinase, N-terminal domain 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|549456165|ref|YP_008604924.1|
Domain Number - Region: 258-306
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0935
Family Galactokinase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549456165|ref|YP_008604924.1|
Sequence length 326
Comment predicted archaeal sugar kinase [Aeropyrum camini SY1 = JCM 12091]
Sequence
MFNAVRISAPSHVHAGNYDIEGSIGRLYGTVGLALEEPRLVLEASPGRGVEVLGGGRRGD
VERFARLYLEKAESRGCSVGGVRLRIHREIPAHVGLGSTTALALSIGASVYRICGIEPLD
LKELAVAAGRSLVSALGLYSFEQGGLIVDGGFVRGERRPPPLVFRMHVPRSVRVVAALPE
RPIPRILDIKRREEELLSRMPSMDPGMAGWASRVVLLGIMANAAEGRWGDAARWMGEFNR
RLGEYWAGEQGGVYCCSEAEEIISAIVDAGAWSGLQSSWGPTVYGLVPARRVSDVVDAAR
KAVEKVGGGRVWATSVDNVGAVISSV
Download sequence
Identical sequences U3TG23
WP_022542256.1.89068 gi|549456165|ref|YP_008604924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]