SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for URET_03822 from Uncinocarpus reesii 1704

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  URET_03822
Domain Number 1 Region: 115-419
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.52e-50
Family Glutamine synthetase catalytic domain 0.00088
Further Details:      
 
Weak hits

Sequence:  URET_03822
Domain Number - Region: 7-96
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000876
Family Glutamine synthetase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) URET_03822
Sequence length 421
Comment | UREG_03822 | Uncinocarpus reesii predicted protein (422 aa)
Sequence
MLSDKEKLEHFLQTNRHIKYIRVQWIDYSGVLRARFVPVERCLRIANGDETIHLAQNSML
IPISTAPKIFPLSDHHETWDLRPDWSSLRPCGFLNNHATVMSFVDQQEAETRFDKCPRMR
LVQALKRLEHEWGAKVKIGFEIEFMLFGSDNNRIRPMDRLNGYSRTAGLRASTMNLVDEI
LNALERSSIRIHHFHAEIEDQLEIALAPEPALDAVDSLVLAQETIRTPCLSGPLNGLHLH
LSLDKIEGALPDNFLAGVLDHMNALCAFGMANYDGYVRSSNDAAGAWIGFGTDNRDMPVR
KISDCRWEFRMMDGTSNPYLFAAVVLYAGLDGLAKKTELRWKDCTFFPHLMTEEMRVEHG
MDVPMPVSLRGALDCLKKDTAVAAWIGDDLLKWYMSVKEKEVEEFSKMHDDQRRIRFLEY
F
Download sequence
Identical sequences C4JLW4
XP_002544305.1.76999 URET_03822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]