SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for URET_03913 from Uncinocarpus reesii 1704

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  URET_03913
Domain Number - Region: 17-47
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0863
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) URET_03913
Sequence length 1372
Comment | UREG_03913 | Uncinocarpus reesii conserved hypothetical protein (1373 aa)
Sequence
MGVPKFFRWLSERYPAISQLIAENRIPEFDCLYLDMNGIIHNCTHKDSDSPTFRMTEDKM
FIAIFNYIEHLFGKIKPKKLFFMAIDGVAPRAKMNQQRARRFRTALDAEMAKEKAIREGV
EMPKEDAFDSNCITPGTEFMAKLTKQLKYFINKKVSEDAEWQGVEVILSGHEVPGEGEHK
IMEYIRQSKAQPGYDPNVRHCLYGLDADLIMLGLLSHDPHFCLLREEVTFGRQSQKKVKE
LEHQNFYLLHLCIVREYLELEFQELEVEGALKFDFDMERIIDDFILMAFFVGNDFLPNLP
NLHINEGALAWMFKVYKEVLPKLDGYINERGRINLDRLGVLLDSLGDVEFRFFEAEYSDA
RWIKSKQNVGEEVQDISRDPKTLTISPAQKHILSKVKKYISHCPVNDDGQSIPLDLSPSL
PARDRKFVEQLADDLRIPWASVANDHGDRFLRLQLPSNQRTANDDDSGDEDEEAQIAVLR
VLKKYDNATVKETTAEDAQQAAEKKYEQKFQEWKNKYYQEKFEWGTDNEEEMRNKKIVPE
AYHSLMTSPDSPIIDFYPRDFELDMNGKKMEWEAVVKIPFINETRLLNAMATKEHLLTPE
EKSRNSFGVTLKFTHSPDIEFTYPSSLVGIFPDIPKCHCIENVYELPTMEGLEPYVGLVD
GAKVGVEALAGFPSLKTLPHSGQLGFHGVTVFQQESRNETMVVTLMESEIRARTEIAKAK
IGKRVHVGYPFLHEALVVCVSDELFDYVQVDGEQHIVPIPHGPGQIEHWKRKADRIESYY
SKRLGMIIGEVESIVHVHVLKGLVKTELGATVKEFAEIPGIETDYASQLIVDEVISQDDR
FIEREAIPIEEEFPEGTKAFFLGEFNYGSPLHITGHEDGKMFGLVSTIKGSKGTRFRPRA
VARSLRLNPLTVAKITSSFSVMSEGKRVNLGLNLKFEAKKLKVLGYSRRGQSGWEFSEKA
ISLLQEYMIKFPDFIAGIQRKPQGDLFEPTDFYPPEIAAAKIKEIQTWLKSVEAKNFERV
PLEAEQLDSDVVGAIEAAADEWFRHKRTGIPQKIKGVPRNAVLKPADAEHRLGNQIFGLG
DRVIYAQDSGKVPIATKGTIVGLTRTARTVLLDVIFDVSFMSGTTLAGRCSPFRGQTVAA
SSVLNLTYKQLIAMTRASNEQVRAQQQAPAQQGYGAPLGPGGAGQLRDAPTPPPLRGSYR
SAVNGQDNSRGMARGRGSPRVLPFRHQPHHDHAPPQASETSPGRNWRGNGHHHHQQHHHH
QQQGNDSTRQNTDSETAARPAASRGRGRGRGGIGSTQLPHSRGGYVSVEKVDPGAGVIMN
NPNFRPRSHNAVPPPANLNQRGAYRGRGFANRGSPRGRGRGRGTATAESQKT
Download sequence
Identical sequences C4JM55
XP_002544396.1.76999 URET_03913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]