SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for URET_01009 from Uncinocarpus reesii 1704

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  URET_01009
Domain Number 1 Region: 36-493
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.08e-73
Family Pyridoxal-dependent decarboxylase 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) URET_01009
Sequence length 508
Comment | UREG_01009 | Uncinocarpus reesii conserved hypothetical protein (509 aa)
Sequence
MTEPVTMEPDEISLAEDHAALERVVLSSGPTARVLPSAQDLEHARALLIKSLPPKGLGFA
QTKDHLLKVVVPGLNFASISPNYYGFVTGGVTPAAWFADNVVSVYDQNVQVHIPDHSVAT
DVEHRALKLLLDLFQLDEKVWAHTTVTSGATASNVLGLACGREFVLCAAAERNGVDCKSV
GEYGIVEVLRASGLKGLQVLSTLPHSSLGKAAGILGIGRANVKSICANQNPLRFDLERLE
MELALPGMASIVAISCGEVNTGRFATGGIEEFQKIRALCDKYNAWLHVDGAFGIFGRILS
HVSDSKEFDSIRKGCEGLELADSITADGHKLLNVPYDCGIFFSRYAKTAQDVFRNPNAAY
LATSAAADTVISPNSIGIENSRRFRALPVYATLIAYGRNGYRAMLEKQIRLARRIATWIF
DQPEYAVLPRVSSKDELLENTFMVVLFSANNDDLNAELVNKINSTSQIYVSGTSWDGRPA
CRIAISNYKVDVERDFARVMGVLQNLVK
Download sequence
Identical sequences C4JFJ5
XP_002541493.1.76999 URET_01009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]