SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for URET_05021 from Uncinocarpus reesii 1704

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  URET_05021
Domain Number 1 Region: 284-553,604-651
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.61e-84
Family IF2B-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) URET_05021
Sequence length 663
Comment | UREG_05021 | Uncinocarpus reesii conserved hypothetical protein (664 aa)
Sequence
MEDSARQKKGFGKVVVALSRRCLRWPKRRLMVLVRRRKKSQVTRSSGEHQLVSANNTSHH
DHHDANGNALEHGLLSSTDTIMSVAKQKIINSAQGGAEEGPGSQLLSGGESSAAKGDESS
ANASAAMNGGAENKNRKKQEAKGGPEAKQGAEKKDSQQQQQQQQGEGPPKLSNAELKKRA
KAEKAARRAKEKQEREGEQAASAQLQNQQQQAKKGGGGGGGAGKQKQGAPAAGTKQAAQR
RGSVHVPAVESKKKKKSENENIVAVFGHLPWHSRRAGIAGVGKEIHPAVVALGMQLRDYV
ICGSSARCVATLLALRRVVQAYITPIGTSLSRHLTTYLSHQINYLTTCRPLSISQGNAIR
ALKLEITTIDPGDSEDEAKQQIYDYIDNYIREKYTVASQVIANSAADRIKDGDVILCYAG
SSVVQKALLTAHAQGKKFRVSIIDTRPLFEGRNFARTLSKAGLEVQYSLINGITTAIRDV
TKVFLGAHAMTSNGCLFSRVGTALVAMSAKERVGGINIPVIVCCETAKFTDRVALDSIVV
NEIADADELVAVEAPEQVTNLSPPTPAPTGKGGKAASTASSATNADTGSIASSLGPTSLV
TDPSQPLQNWREMKNLQLLNIMHDVTPAQYIDMVITEMGSLPPSAVPIVHRMSTESEEKD
AKH
Download sequence
Identical sequences C4JRD2
XP_002584332.1.76999 URET_05021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]