SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for URET_05143 from Uncinocarpus reesii 1704

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  URET_05143
Domain Number 1 Region: 110-519
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.87e-106
Family Pyridoxal-dependent decarboxylase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) URET_05143
Sequence length 571
Comment | UREG_05143 | Uncinocarpus reesii sphingosine-1-phosphate lyase (572 aa)
Sequence
MHPNIPMTLQKVMTATRASSDVLFTLSNLNIIRNLVFVVFLLRLARKSFYTVRGHGVVGT
ISNVYHKVQLLLYSLFLRSPGVRGQVDKQVSSAISKLETKLAPQGPGTIKYNSLPKQGWT
AEQVRAELDKLSGMEHTMWEDGRVSGAVYHGGDDLLKLQTAAWGQFAVANPIHPDVFPGV
RKMEAEVVAMVLALFNAPKGGAGVTTSGGTESILMACLSARQKAYAERGVTEPEMIIPNT
AHAAFNKASQYFGIKLHSVPCPGPKHTIHIPSVRRLINPNTILLVGSAPNFPHGIVDDIP
ALSRLAVSYKIPLHVDCCLGSFVIAFLKKAGYASPYEEQGGFDFRLPGVTSISIDTHKYG
FAPKGNSVVLYRNRTLRSYQYFILPEWSGGVYASPSIAGSRPGALIAGCWASLMAIGESG
YKDSCHQIVGAAKKFEASIREDPVLSRDLKVVGEPMVSVVAFAATTAEIDIYDIADAMSA
KGWHLNALQNPPAMHVAFTIPTANAVDKLTTDLVEVVELERAKADERRRLGQKVEKERGD
TSALYGVAGSIPDKSIVSRLAEGFLDTLYLS
Download sequence
Identical sequences C4JRQ4
XP_002584454.1.76999 URET_05143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]