SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for URET_06999 from Uncinocarpus reesii 1704

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  URET_06999
Domain Number 1 Region: 3-373
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.17e-108
Family IF2B-like 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) URET_06999
Sequence length 386
Comment | UREG_06999 | Uncinocarpus reesii S-methyl-5-thioribose-1-phosphate isomerase (387 aa)
Sequence
MASALEAIKYDRGRLFIIDQLQLPHVTKFIPIDSSEAGWHAIKAMQVRGAPAIAIVAVLS
LAVEMLNLVSENMIPEDGEDVRAYIEQKMDYLVSSRPTAVNLSDSAQKIKLLLDQRARKS
GLSGVETAMAFIQHAEQMLARDLADNHSIGEYGATWILKNTRAALEGGNTCVLTHCNTGS
LATAGYGTALGIIRRLHEHGRLSRAYCTETRPYNQGARLTAYELVSDKIPATLITDSMAG
QLLANPDKKIAAIVVGADRVAANGDTANKIGTYTLAVLAKFHNIKFVVAAPRTTIDMKTK
TGNEIIIEERQSSEVTKIRGPCEGDGDHREAVMETIKIAADGIDVWNPAFDVTPAALIDA
IVTEVGVETKDSSGQFHLSSLFESMA
Download sequence
Identical sequences C4JWQ7
URET_06999 XP_002584032.1.76999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]