SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|5094|gm1.1503_g from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|5094|gm1.1503_g
Domain Number 1 Region: 168-387
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.31e-88
Family ATP sulfurylase catalytic domain 0.0000000217
Further Details:      
 
Domain Number 2 Region: 2-167
Classification Level Classification E-value
Superfamily PUA domain-like 1.29e-56
Family ATP sulfurylase N-terminal domain 0.000000588
Further Details:      
 
Domain Number 3 Region: 388-489,517-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.14e-22
Family ATP sulfurylase C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|5094|gm1.1503_g
Sequence length 550
Sequence
MLTPHGGVLQDLIQRDASKKDELLKEAEQLRSIVLNARQTCDLELILNGGFSPLTGFLNQ
NDYNSVVHDLRLSDGTLWPMPINLDVSEKVASPLKPKDRIVLRDPRDDEPLAIITIQDIY
KPDKDVEAKEVFRGDPDHPAVRYLYDVAGEYYIGGNLEAINLPRHYDYSELRETPAQLRS
EFASRHWTRVVAFQTRNPMHRAHRELTVRAAHDKLANVLIHPVVGLTKPGDIDYHTRVKV
YREIIKKYPTGMAKLALLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNRNG
VPFYGPYDAQTLVKKYAKELQIQVVPFRMMSYLPEEDKYAPADTIPEGTKTLNISGTELR
RRLKTGAKIPEWFSYPEVVEILRTSYPPRPKQGFALYLAGLPYSGVSALGNALQATFNQF
KGGRHITLLDGSGIPSEAYPEVISQLIRSGAGVIVADSKNSDGAIYSQESISKLRTTVSK
AGSFILVSVETPLEQRLKHDRFGFYNKHPEAKEVKTINDADIVADLSNDGIYVSISKIIL
YLEEAGFYKF
Download sequence
Identical sequences jgi|Dekbr2|5094|gm1.1503_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]